menu
search
Log In
Welcome to GATE BioTechnology, where you can ask questions and receive answers from other members of the community.

GATE2015-26

0 votes

Identify the file format given below:

$>$P$1$; JMFD

Protein X – Homo sapiens

MKALTARQQEVFDLIRDHISRTLRQQGDWL

  1. GDE
  2. FASTA
  3. NBRF
  4. GCG
in Others 7.9k points
edited by

Please log in or register to answer this question.

Answer:

Related questions

0 votes
0 answers
1
GATE2015-11
Which one of the following complement proteins is the initiator of the membrane attack complex $C3a$ $C3b$ $C5a$ $C5b$
Which one of the following complement proteins is the initiator of the membrane attack complex $C3a$ $C3b$ $C5a$ $C5b$
asked Mar 26, 2018 in Others Milicevic3306 7.9k points
0 votes
0 answers
2
GATE2015-12
Levinthal’s paradox is related to protein secretion protein degradation protein folding protein trafficking
Levinthal’s paradox is related to protein secretion protein degradation protein folding protein trafficking
asked Mar 26, 2018 in Others Milicevic3306 7.9k points
0 votes
0 answers
3
GATE2015-13
Which one of the following is a second generation genetically engineered crop? Bt brinjal Roundup soyabean Golden rice Bt rice
Which one of the following is a second generation genetically engineered crop? Bt brinjal Roundup soyabean Golden rice Bt rice
asked Mar 26, 2018 in Others Milicevic3306 7.9k points
0 votes
0 answers
4
GATE2015-14
Based on the heavy chain, which one of the following antibodies has multiple subtypes? IgM IgD IgE IgG
Based on the heavy chain, which one of the following antibodies has multiple subtypes? IgM IgD IgE IgG
asked Mar 26, 2018 in Others Milicevic3306 7.9k points
0 votes
0 answers
5
GATE2015-15
The Cytokinetic organelle in plant cells is centriole Phragmoplast proplastid chromoplastid
The Cytokinetic organelle in plant cells is centriole Phragmoplast proplastid chromoplastid
asked Mar 26, 2018 in Others Milicevic3306 7.9k points
Dark theme
Muffin by Hélio Chun
Thanks to Q2A
...