search
Log In
Welcome to GATE BioTechnology, where you can ask questions and receive answers from other members of the community.
0 votes

Identify the file format given below:

$>$P$1$; JMFD

Protein X – Homo sapiens

MKALTARQQEVFDLIRDHISRTLRQQGDWL

  1. GDE
  2. FASTA
  3. NBRF
  4. GCG
in Others 7.9k points
edited by

Please log in or register to answer this question.

...