in Others edited by
0 votes
0 votes

Identify the file format given below:

$>$P$1$; JMFD

Protein X – Homo sapiens

MKALTARQQEVFDLIRDHISRTLRQQGDWL

  1. GDE
  2. FASTA
  3. NBRF
  4. GCG
in Others edited by
by
7.9k points

Please log in or register to answer this question.

Welcome to GATE BioTechnology, where you can ask questions and receive answers from other members of the community.