edited by
0 votes
0 votes

Identify the file format given below:

$>$P$1$; JMFD

Protein X – Homo sapiens

MKALTARQQEVFDLIRDHISRTLRQQGDWL

  1. GDE
  2. FASTA
  3. NBRF
  4. GCG
edited by

Please log in or register to answer this question.

Answer:

Related questions

0 votes
0 votes
0 answers
1
Milicevic3306 asked Mar 26, 2018
Which one of the following complement proteins is the initiator of the membrane attack complex$C3a$$C3b$$C5a$$C5b$
0 votes
0 votes
0 answers
2
Milicevic3306 asked Mar 26, 2018
Levinthal’s paradox is related toprotein secretionprotein degradationprotein foldingprotein trafficking
0 votes
0 votes
0 answers
3
Milicevic3306 asked Mar 26, 2018
Which one of the following is a second generation genetically engineered crop?Bt brinjalRoundup soyabeanGolden riceBt rice
0 votes
0 votes
0 answers
4
Milicevic3306 asked Mar 26, 2018
Based on the heavy chain, which one of the following antibodies has multiple subtypes?IgMIgDIgEIgG
0 votes
0 votes
0 answers
5
Milicevic3306 asked Mar 26, 2018
The Cytokinetic organelle in plant cells iscentriolePhragmoplastproplastidchromoplastid