0 votes 0 votes Identify the file format given below: $>$P$1$; JMFD Protein X – Homo sapiens MKALTARQQEVFDLIRDHISRTLRQQGDWL GDE FASTA NBRF GCG Others gate2015 + – Milicevic3306 asked Mar 26, 2018 • edited Nov 29, 2020 by go_editor Milicevic3306 7.9k points answer comment Share Follow See all 0 reply Please log in or register to add a comment.