GATE Overflow for GATE BT - Questions without answers in Bioinformatics

GATE BT 2026 | Question: 20

Mon, 23 Feb 2026 14:21:39 +0000

BLAST and its extensions can be used to determine similarity of a query protein sequence with which of the following database(s)?

A database of translated nucleotide sequences
A database of binding ligands and small translated peptides
A database of protein structures
A database of binding, linking and self-assembling proteins

GATE BT 2025 | Question: 37

Thu, 06 Mar 2025 17:05:00 +0000

Correctly match the following Bioinformatic tool/Database with its respective Utility.

\begin{array}{|l|l|}
\hline \textbf{Bioinformatic tool/Database} & \textbf{Utility} \\
\hline \text{P. BLAST} & 1. \text{Database for 3D protein structures} \\
\hline \text{Q. Bowtie} & 2. \text{Tool to identify similarity of a query} \\ & \text{sequence to existing sequences} \\ & \text{ available in databanks} \\
\hline \text{R. AlphaFold} & 3. \text{Tool to align short read DNA sequences} \\ &
\text{obtained from Next-generation} \\ & \text{sequencing to a reference genome} \\
\hline \text{S. PDB} & 4. \text{AI tool to predict protein structures} \\ \hline
\end{array}

$\mathrm{P}-2 ; \mathrm{Q}-3 ; \mathrm{R}-1 ; \mathrm{S}-4$
$\mathrm{P}-2 ; \mathrm{Q}-3 ; \mathrm{R}-4 ; \mathrm{S}-1$
$\mathrm{P}-3 ; \mathrm{Q}-2 ; \mathrm{R}-4 ; \mathrm{S}-1$
$\mathrm{P}-4 ; \mathrm{Q}-1 ; \mathrm{R}-2 ; \mathrm{S}-3$

GATE BT 2023 | Question: 16

Sun, 21 May 2023 02:58:38 +0000

Which one of the following programs is used for finding distantly related (or remote) protein homologs?

BLASTN
BLASTX
PSI-BLAST
TBLASTX

GATE BT 2023 | Question: 17

Sun, 21 May 2023 02:58:37 +0000

Which one of the following is used for global alignment of two protein sequences?

Chou-Fasman method
Garnier-Osguthorpe-Robson (GOR) method
Needleman-Wunsch algorithm
Smith-Waterman algorithm

GATE BT 2022 | Question: 14

Sun, 20 Mar 2022 16:16:29 +0000

Which of the following is $\text{NOT}$ used for generating an optimal alignment of two nucleotide sequences?

Gap penalties
Match scores
Mismatch scores
Nucleotide composition

GATE BT 2022 | Question: 34

Sun, 20 Mar 2022 16:16:27 +0000

The maximum parsimony method is used to construct a phylogenetic tree for a set of sequences. Which one of the following statements about the method is $\text{CORRECT}?$

It predicts the tree that minimizes the steps required to generate the observed variations
It predicts the tree that maximizes the steps required to generate the observed variations
It predicts the tree with the least number of branch points
It employs probability calculations to identify the tree

GATE BT 2021 | Question: 3

Mon, 01 Mar 2021 03:19:51 +0000

Number of unrooted trees in a phylogeny of five sequences is

$3$
$15$
$105$
$945$

GATE BT 2021 | Question: 4

Mon, 01 Mar 2021 03:19:51 +0000

Which one of the following methods is used to test the significance of a predicted phylogeny?

Bootstrap
Maximum likelihood
Maximum parsimony
Minimum evolution

GATE BT 2021 | Question: 32

Mon, 01 Mar 2021 03:19:48 +0000

Which one of the following tools is used to compare all the possible six-open reading frames of a given nucleotide query sequence with all the available six-open reading frames of the nucleotide sequence database?

$\text{BLASTN}$
$\text{BLASTX}$
$\text{TBLASTN}$
$\text{TBLASTX}$

GATE2019: 29

Tue, 03 Nov 2020 12:03:23 +0000

Which of the following statements are $CORRECT$ when a protein sequence database is searched using the $BLAST$ algorithm?

A larger E-value indicates higher sequence similarity
E-value $<10^{-10}$ indicates sequence homology
A higher BLAST score indicates higher sequence similarity
E-value $>10^{10}$ indicates sequence homology

$P, Q$ and $R$ only
$Q$ and $R$ only
$P, R$ and $S$ only
$P$ and $S$ only

GATE2020: 43

Tue, 03 Nov 2020 11:14:30 +0000

The sequence of a $1$ $Mb$ long $DNA$ is random. This $DNA$ has all four bases occurring in equal proportion. The number of nucleotides, on average, between two successive $EcoRI$ recognition site $GAATTC$ is ____________.

GATE2019: 4

Tue, 03 Nov 2020 04:04:45 +0000

Which one of the following is a database of protein sequence motifs?

$PROSITE$
$TrEMBL$
$SWISSPROT$
$PDB$

GATE2019: 19

Tue, 03 Nov 2020 04:04:44 +0000

The number of possible rooted trees in a phylogeny of three species is ______.

GATE2016-8

Mon, 26 Mar 2018 16:59:52 +0000

Which one of the following is NOT an algorithm for building phylogenetic trees?

Maximum parsimony
Neighbor joining
Maximum likelihood
Bootstrap

GATE BT 2015 | Question: 26

Mon, 26 Mar 2018 15:10:48 +0000

Identify the file format given below:

$>$P$1$; JMFD

Protein X – Homo sapiens

MKALTARQQEVFDLIRDHISRTLRQQGDWL

GDE
FASTA
NBRF
GCG

GATE BT 2015 | Question: 37

Mon, 26 Mar 2018 15:10:46 +0000

How many rooted and unrooted phylogenetic trees, respectively, are possible with four different sequences?

$3$ and $15$
$15$ and $3$
$15$ and $12$
$12$ and $3$

GATE BT 2015 | Question: 53

Mon, 26 Mar 2018 15:10:44 +0000

Consider the following multiple sequence alignment of four DNA sequences.

$$\begin{array}{cccc} A & C & T & A \\ A & C & T & G \\ A & G & T & C \\ A & G & C & T \end{array}$$Shannon's entropy of the above alignment is ___________

GATE2014-22

Sun, 25 Mar 2018 23:27:39 +0000

The algorithm for BLAST is based on

Dynamic Programming
Hidden Markov Model
k-tuple analysis
Neural Network

GATE2014-43

Sun, 25 Mar 2018 23:27:36 +0000

In an affine gap penalty model, if the gap opening penalty $-20$, gap extension penalty is $-4$ and gap length is $8$, the gap score is__________.

GATE BT 2013 | Question: 36

Sun, 25 Mar 2018 20:06:01 +0000

Determine the correctness or otherwise of the following $\text{Assertion (a) and Reason (r)}$.

$\text{Assertion:}$ $\text{UPGMA}$ method produces ultrametric tree.

$\text{Reason:}$ Sequence alignment is converted into evolutionary distances in $\text{UPGMA}$ method.

Both $(a)$ and $(r)$ are true and $(r)$ is the correct reason for $(a)$
Both $(a)$ and $(r)$ are true and $(r)$ is not the correct reason for $(a)$
$(a)$ is true but $(r)$ is false
$(a)$ is false but $(r)$ is true

GATE BT 2013 | Question: 24

Sun, 25 Mar 2018 20:05:59 +0000

Calculate the percentage sequence identity for the pairwise alignment given below. ______________

$\text{HELLO-}$
$\text{YELLOW}$

GATE BT 2012 | Question: 22

Sun, 25 Mar 2018 08:38:44 +0000

While searching a database for similar sequences, E value does NOT depend on the

sequence length
number of sequences in the database
scoring system
probability from a normal distribution

GATE BT 2012 | Question: 19

Sun, 25 Mar 2018 08:38:43 +0000

An example of a derived protein structure database is

Pfam
SCOP
GEO
Prosite

GATE BT 2012 | Question: 20

Sun, 25 Mar 2018 08:38:43 +0000

An example of a program for constructing a phylogenetic tree is

phylip
phrap
prodom
PHDsec