search
Log In
Welcome to GATE BioTechnology, where you can ask questions and receive answers from other members of the community.

Recent activity

0 votes
0 answers
1
For a discrete random variable $X$, $\textit{ran}(X)=\{0,1,2,3\}$ and the cumulative probability $F(X )$ is shown below: $\begin{array}{|c|c|c|c|c|} \hline X & 0 & 1 & 2 & 3 \\ \hline F(X) & 0.5 & 0.6 & 0.8 & 1.0 \\ \hline \end{array}$The mean value of $X$ is ___________
edited 10 hours ago in Others jothee 100 points
0 votes
0 answers
2
What are the eigenvalues of the following matrix? $\begin{bmatrix} 1 & 1 \\ -2 & 4 \end{bmatrix}$ $2$ and $3$ $-2$ and $3$ $2$ and $-3$ $-2$ and $-3$
edited 10 hours ago in Others jothee 100 points
0 votes
0 answers
3
Match the compounds in $\text{Group I}$ with the correct entries in $\text{Group II}$ ... $\text{P-5, Q-2, R-1, S-3}$ $\text{P-4, Q-2, R-1, S-3}$ $\text{P-4, Q-5, R-3, S-1}$
edited 10 hours ago in Others jothee 100 points
0 votes
0 answers
4
How many rooted and unrooted phylogenetic trees, respectively, are possible with four different sequences? $3$ and $15$ $15$ and $3$ $15$ and $12$ $12$ and $3$
edited 11 hours ago in Others jothee 100 points
0 votes
0 answers
5
An isolated population on an island has the following genotypic frequencies: $\begin{array}{|c|c|c|c|} \hline \textrm{Genotype} & AA & Aa & aa \\ \hline \textrm{Frequency} & 0.3 & 0.4 & 0.3 \\ \hline \end{array}$ Assuming that there are only two alleles ($A$ and $a$) for the gene, the genotypic frequency of $AA$ in the next generation will be __________
edited 11 hours ago in Others jothee 100 points
0 votes
0 answers
6
The interaction between an antigen $(Ag)$ and a single-chain antibody $(Ab)$ was studied using Scatchard analysis. The result is shown below. The affinity of interaction and the total concentration of antibody, respectively, can be determined from slope and $Y$-intercept $Y$-intercept and slope $X$-intercept and slope slope and $X$-intercept
edited 11 hours ago in Others jothee 100 points
0 votes
0 answers
7
$\begin{array}{cc} 2x_1+ x_2 = 35 \\ 5x_1 + bx_2 = 7.5 \end{array}$ The system of linear equations in two variables shown above will have infinite solutions, if and only if, $b$ is equal to _________
edited 11 hours ago in Others jothee 100 points
0 votes
0 answers
8
Consider the following infinite series: $1+ r+r^2 +r^3+ \dots \dots \infty$ If $r = 0.3$, then the sum of this infinite series is ____________
edited 11 hours ago in Others jothee 100 points
0 votes
0 answers
9
Choose the appropriate pair of primers to amplify the following DNA fragment by the polymerase chain reaction (PCR). $\textrm{5' - GACCTGTGG- - - - - - - - - - - - - - - - - - ATACGGGAT - 3'}$ $\textrm{3' - CTGGACACC - - - - - - - - - - - - - - - - - - TATGCCCTA - 5'}$ ... $P$ and $R$ $P$ and $S$ $Q$ and $R$ $Q$ and $S$
edited 11 hours ago in Others jothee 100 points
0 votes
0 answers
10
Which one of the following graphs represents uncompetitive inhibition?
edited 11 hours ago in Others jothee 100 points
0 votes
0 answers
11
Which one of the following amino acids has the highest probability to be found on the surface of a typical globular protein in aqueous environment? Ala Val Arg Ile
edited 1 day ago in Others jothee 100 points
0 votes
0 answers
12
A single subunit enzyme converts $420$ $\mu$moles of substrate to product in one minute. The activity of the enzyme is ________ $\times 10^{-6}$ Kalal.
edited 1 day ago in Others jothee 100 points
0 votes
0 answers
13
Which one of the following organisms is used for the determination of phenol coefficient of a disinfectant? Salmonella typhi Escherichia coli Candida albicans Bacillus psychrophilus
edited 1 day ago in Others jothee 100 points
0 votes
0 answers
14
ABO blood group antigens in humans are differentiated from each other on the basis of sialic acid lipids spectrin glycoproteins
edited 1 day ago in Others jothee 100 points
0 votes
0 answers
15
Anergy refers to nitochondrial dysfunction allergy to environmental antigens unresponsiveness to antigens a state of no energy
edited 1 day ago in Others jothee 100 points
0 votes
0 answers
16
In DNA sequencing reactions using the chain termination method, the ratio of ddNTPs to dNTPs should be $0$ $< 1$ $1$ $>1$
edited 1 day ago in Others jothee 100 points
0 votes
0 answers
17
How many different protein sequences of $100$ residues can be generated using $20$ standard amino acids? $100^{20}$ $100 \times 20$ $20^{100}$ $100! \times 20!$
edited 1 day ago in Others jothee 100 points
0 votes
0 answers
18
How many $3$-tuples are possible for the following amino acid sequence? MADCMWDISEASE $4$ $5$ $11$ $12$
edited 1 day ago in Others jothee 100 points
0 votes
0 answers
19
Which one of the following relations holds true for the specific growth rate $(\mu)$ of a microorganism in the death phase? $\mu=0$ $\mu<0$ $\mu=\mu_{\text{max}}$ $0<\mu<\mu_{\text{max}}$
edited 1 day ago in Others jothee 100 points
0 votes
0 answers
20
Identify the file format given below: $>$P$1$; JMFD Protein X – Homo sapiens MKALTARQQEVFDLIRDHISRTLRQQGDWL GDE FASTA NBRF GCG
edited 1 day ago in Others jothee 100 points
0 votes
0 answers
21
Which one of the following is INCORRECT about a typical apoptotic cell? Phosphatidylserine is presented on the outer cell surface Cytochrome c is released from mitochondria Mitochondrial membrane potential does not change Annexin-V binds to the cell surface
edited 1 day ago in Others jothee 100 points
0 votes
0 answers
22
Production of monoclonal antibodies by hybridoma technology requires splenocytes osteocytes hepatocytes thymocytes
edited 1 day ago in Others jothee 100 points
0 votes
0 answers
23
Which one of the following features is NOT required in a prokaryotic expression vector? $\textit{oriC}$ Selection marker CMV promoter Ribosome binding site
edited 1 day ago in Others jothee 100 points
0 votes
0 answers
24
The determinant of the matrix $\begin{bmatrix} 3 & 0 & 0 \\ 2 & 5 & 0 \\ 6 & -8 & -4 \end{bmatrix}$ is __________
edited 1 day ago in Others jothee 100 points
0 votes
0 answers
25
Which one of the following is NOT a product of denitrification in Pseuadomonas? $N_2$ $N_2O$ $NO_2^-$ $NH_4^+$
edited 1 day ago in Others jothee 100 points
0 votes
0 answers
26
The Cytokinetic organelle in plant cells is centriole Phragmoplast proplastid chromoplastid
edited 2 days ago in Others jothee 100 points
0 votes
0 answers
27
Based on the heavy chain, which one of the following antibodies has multiple subtypes? IgM IgD IgE IgG
edited 2 days ago in Others jothee 100 points
0 votes
0 answers
28
Which one of the following is a second generation genetically engineered crop? Bt brinjal Roundup soyabean Golden rice Bt rice
edited 2 days ago in Others jothee 100 points
0 votes
0 answers
29
Levinthal’s paradox is related to protein secretion protein degradation protein folding protein trafficking
edited 2 days ago in Others jothee 100 points
0 votes
0 answers
30
Which one of the following complement proteins is the initiator of the membrane attack complex $C3a$ $C3b$ $C5a$ $C5b$
edited 2 days ago in Others jothee 100 points
0 votes
0 answers
31
Humpty Dumpty sits on a all every day while having lunch. The wall sometimes breaks. A person sitting on the all falls if the wall breaks. Which one of the statements below is logically valid and can be inferred from the above sentences? Humpty Dumpty always ... sometimes while having lunch Humpty Dumpty never falls during dinner When Humpty Dumpty does not sit on the wall, the wall does not break
edited 2 days ago in Others jothee 100 points
0 votes
0 answers
32
A cube of side $3$ units is formed using a set of smaller cubes of side $1$ unit. Find the proportion of the number of faces of the smaller cubes visible to those which are NOT visible. $1:4$ $1:3$ $1:2$ $2:3$
edited 2 days ago in Others jothee 100 points
0 votes
0 answers
33
Fill in the missing value
edited 2 days ago in Others jothee 100 points
0 votes
0 answers
34
Read the following paragraph and choose the correct statement. Climate change has reduced human security and threatened human well being. An ignored reality of human progress is that human security largely depends upon environmental security. ... contradictory to environmental security. Human security is contradictory to environmental security. Human progress depends upon environmental security.
edited 2 days ago in Others jothee 100 points
0 votes
0 answers
35
The following question presents a sentence. part of which is underlined. Beneath the sentence you find four ways of phrasing the underlined part. Following the requirements of the standard written English, select the answer that produces the most effective sentence. Tuberculosis, together ... causes of death has the rank of one of the leading causes of death are one of the leading causes of death
edited 2 days ago in Others jothee 100 points
0 votes
0 answers
36
If $\log_x (5/7) = -1/3$, then the value of $x$ is $343/125$ $125/343$ $-25/49$ $-49/25$
edited 2 days ago in Others jothee 100 points
0 votes
0 answers
37
Operators $\square$, $\lozenge$ and $\rightarrow$ are defined by: $a \: \square \: b = \dfrac{a-b}{a+b}$; $a \: \lozenge \: b = \dfrac{a+b}{a-b}$; $a \rightarrow b = ab$. Find the value of $(66 \: \square \: 6) \rightarrow (66 \: \lozenge \: 6)$. $-2$ $-1$ $1$ $2$
edited 2 days ago in Others jothee 100 points
0 votes
0 answers
38
Choose the word most similar in meaning to the given word: Educe Exert Educate Extract Extend
edited 2 days ago in Others jothee 100 points
0 votes
0 answers
39
Choose the appropriate word/phrase, out of the four options given below, to complete the following sentence: Frogs _________ croak roar hiss patter
edited 2 days ago in Others jothee 100 points
0 votes
0 answers
40
Choose the most appropriate word from the options given below to complete the following sentence. The principal presented the chief guest with a _________, as token of appreciation. momento memento momentum moment
edited 2 days ago in Others jothee 100 points
To see more, click for the full list of questions or popular tags.
...