Register
Filter

Most viewed questions in Others

0 votes
0 answers
201
GATE2016-31
Match the secondary metabolites (Column-I) with the corresponding plant species (Column-II). ... $\text{P-2, Q-3, R-4, S-1}$ $\text{P-4: Q-1, R-2, S-3}$
Match the secondary metabolites (Column-I) with the corresponding plant species (Column-II).$\begin{array}{|l|l|l|l|} \hline & \textbf{Column-I} & &\textbf{Column-II} \\ ...
0 votes
0 answers
202
GATE BT 2023 | Question: 31
Which of the following statement(s) is(are) TRUE about induced pluripotent stem cells? They can self-renew They require specific signals to maintain their stemness They cannot be genetically manipulated They can form organoids in vitro
Which of the following statement(s) is(are) TRUE about induced pluripotent stem cells?They can self-renewThey require specific signals to maintain their stemnessThey cann...
0 votes
0 answers
205
GATE2015-20
Which one of the following amino acids has the highest probability to be found on the surface of a typical globular protein in aqueous environment? Ala Val Arg Ile
Which one of the following amino acids has the highest probability to be found on the surface of a typical globular protein in aqueous environment?AlaValArgIle
0 votes
0 answers
206
GATE2012-31
Match the terms in $\textbf{Group I}$ with the ploidy in $\textbf{Group II}$ ... $\text{P-4, Q-3, R-1, S-2}$ $\text{P-2, Q-3, R-4, S-1}$ $\text{P-l, Q-4, R-3, S-2}$
Match the terms in $\textbf{Group I}$ with the ploidy in $\textbf{Group II}$.$\begin{array}{|C|l|C|l|} \hline &\textbf{Group I} & {} &\textbf{Group II} \\\hline P. &\text...
0 votes
0 answers
207
GATE BT 2022 | Question: 30
Match the stationary phase (Column I) with its corresponding chromatography technique (Column II). ... $\text{P-3, Q-4, R-2, S-1}$ $\text{P-4, Q-1, R-3, S-2}$
Match the stationary phase (Column I) with its corresponding chromatography technique (Column II).$$\begin{array} {lll} \textbf{Column I} & & \textbf{Column II} \\ \text{...
0 votes
0 answers
208
GATE2016-12
Which one of the following is NOT used for the measurement of cell Viability in animal cell culture? Trypan blue dye exclusion Tetrazolium (MTT) assay LDH activity in the culture medium Coulter counter
Which one of the following is NOT used for the measurement of cell Viability in animal cell culture?Trypan blue dye exclusionTetrazolium (MTT) assayLDH activity in the cu...
0 votes
0 answers
209
GATE BT 2022 | Question: 10
Match the component of eukaryotic cells (Column I) with its respective function (Column II). ... $\text{P-3, Q-1, R-2, S-4}$ $\text{P-4, Q-3, R-1, S-2}$
Match the component of eukaryotic cells (Column I) with its respective function (Column II).$$\begin{array}{lll} \textbf{Column I} & & \textbf{Column II} \\ \text{P. Lyso...
0 votes
0 answers
210
GATE2019: 26
In general, which one of the following statements is $NOT \;CORRECT$? Hydrogen bonds result from electrostatic interactions Hydrogen bonds contribute to the folding energy of proteins Hydrogen bonds are weaker than van der Waals interactions Hydrogen bonds are directional
In general, which one of the following statements is $NOT \;CORRECT$?Hydrogen bonds result from electrostatic interactionsHydrogen bonds contribute to the folding energy ...
0 votes
0 answers
211
GATE2017-9
Which one of the following techniques can be used to determine the structure of a $15$ kDa globular protein at atomic resolution? Raman spectroscopy IR spectroscopy UV spectroscopy NMR spectroscopy
Which one of the following techniques can be used to determine the structure of a $15$ kDa globular protein at atomic resolution?Raman spectroscopyIR spectroscopyUV spect...
0 votes
0 answers
212
GATE2014-39
Match the following plant sources with their secondary metabolites and medical uses: ... $\text{P-1-b, Q-4-c, R-2-d, S-3-a}$
Match the following plant sources with their secondary metabolites and medical uses:$\begin{array}{|l|l|l|} \hline \textbf{Source plant} & \textbf{Secondary metabolites} ...
0 votes
0 answers
213
GATE BT 2024 | Question: 16
If a denatured protein of human origin is injected into a rabbit, antibodies generated will recognize the $\_\_\_\_\_\_$ structure of the protein. primary secondary tertiary quaternary
If a denatured protein of human origin is injected into a rabbit, antibodies generated will recognize the $\_\_\_\_\_\_$ structure of the protein.primarysecondarytertiary...
0 votes
0 answers
215
GATE2015-28
How many $3$-tuples are possible for the following amino acid sequence? MADCMWDISEASE $4$ $5$ $11$ $12$
How many $3$-tuples are possible for the following amino acid sequence?MADCMWDISEASE$4$$5$$11$$12$
0 votes
0 answers
217
GATE BT 2024 | Question: 20
The solution of the differential equation $\frac{d y}{d x}=y+e^{-x}$ that satisfies $y(0)=-\frac{1}{2}$ is $\_\_\_\_\_\_\_$. $-\frac{1}{2} e^{-\frac{x}{2}}$ $-\frac{1}{2} e^{x}$ $-\frac{1}{2} e^{-x}$ $-\frac{1}{2} e^{\frac{x}{2}}$
The solution of the differential equation $\frac{d y}{d x}=y+e^{-x}$ that satisfies $y(0)=-\frac{1}{2}$ is $\_\_\_\_\_\_\_$.$-\frac{1}{2} e^{-\frac{x}{2}}$$-\frac{1}{2} e...
0 votes
0 answers
219
GATE2014-11
Since mammalian cells are sensitive to shear, scale-up of a mammalian cell process must consider, among other parameters, the following $\text{(given N=rotations/time, D=diameter of impeller)}$ $\pi ND$ $\pi N^2D$ $\pi ND^2$ none of these
Since mammalian cells are sensitive to shear, scale-up of a mammalian cell process must consider, among other parameters, the following $\text{(given N=rotations/time, D=...
0 votes
0 answers
220
GATE2014-14
A bacterium belonging to cocci group has a diameter of $2\:\mu m.$ The numerical value of the ratio of its surface area to volume (in $\mu m^{-1}$) is _______.
A bacterium belonging to cocci group has a diameter of $2\:\mu m.$ The numerical value of the ratio of its surface area to volume (in $\mu m^{-1}$) is _______.
0 votes
0 answers
221
GATE2013-55
What is the holding period (min) at a $K$ value of $\text{3.36min}^{-1}?$ $10.6$ $9.5$ $8.4$ $7.2$
What is the holding period (min) at a $K$ value of $\text{3.36min}^{-1}?$$10.6$$9.5$$8.4$$7.2$
0 votes
0 answers
223
GATE2019: 25
Protein concentration of a crude enzyme preparation was $10\:mg\:mL^{-1}$. $10\:\mu L$ of this sample gave an activity of $5\:\mu mol\:min^{-1}$ under standard assay conditions. The specific activity of this crude enzyme preparation is ____________ units $mg^{-1}$.
Protein concentration of a crude enzyme preparation was $10\:mg\:mL^{-1}$. $10\:\mu L$ of this sample gave an activity of $5\:\mu mol\:min^{-1}$ under standard assay cond...
0 votes
0 answers
225
GATE2016-11
Junctional diversity of antibody molecules results from the addition of switch region nucleotides the addition of N and P nucleotides the joining of V, D and J segments mutations in complementarity-determining regions
Junctional diversity of antibody molecules results fromthe addition of switch region nucleotidesthe addition of N and P nucleotidesthe joining of V, D and J segmentsmutat...
0 votes
0 answers
226
GATE2017-38
Match the plant hormones in $\textbf{Column I}$ with functions in $\textbf{Column II}$ ... $\text{P-3, Q-1, R-2, S-4}$ $\text{P-2, Q-1, R-4, S-3}$
Match the plant hormones in $\textbf{Column I}$ with functions in $\textbf{Column II}$$\begin{array}{|l|l|l|l|} \hline & \textbf{Column I} && \text{Column II} \\ \hline ...
0 votes
0 answers
227
GATE2015-26
Identify the file format given below: $>$P$1$; JMFD Protein X – Homo sapiens MKALTARQQEVFDLIRDHISRTLRQQGDWL GDE FASTA NBRF GCG
Identify the file format given below:$>$P$1$; JMFDProtein X – Homo sapiensMKALTARQQEVFDLIRDHISRTLRQQGDWLGDEFASTANBRFGCG
0 votes
0 answers
228
GATE BT 2023 | GA Question: 9
The coefficient of $x^{4}$ in the polynomial $(x-1)^{3}(x-2)^{3}$ is equal to __________. $33$ $-3$ $30$ $21$
The coefficient of $x^{4}$ in the polynomial $(x-1)^{3}(x-2)^{3}$ is equal to __________.$33$$-3$$30$$21$
0 votes
0 answers
231
GATE2014-46
Match the immunoglobulin class in $\text{Group I}$ with its properties in $\text{Group II}$ ... $\text{P-4, Q-3, R-1, S-2}$ $\text{P-1, Q-4, R-3, S-2}$
Match the immunoglobulin class in $\text{Group I}$ with its properties in $\text{Group II}$$\begin{array}{|l|l|l|l|} \hline & \textbf{Group I} && \textbf{Group II} \\ \hl...
0 votes
0 answers
232
GATE2014-51
If protoplasts are placed in distilled water, they swell and burst as a result of endosmosis. The plot representing the kinetics of burst is
If protoplasts are placed in distilled water, they swell and burst as a result of endosmosis.The plot representing the kinetics of burst is
0 votes
0 answers
233
GATE2020: 1
Protein $P$ becomes functional upon phosphorylation of a serine residue. Replacing this serine with _____________ will result in a phosphomimic mutant of $P$. alanine aspartic acid phenylalanine lysine
Protein $P$ becomes functional upon phosphorylation of a serine residue. Replacing this serine with _____________ will result in a phosphomimic mutant of $P$.alanineaspar...
0 votes
0 answers
234
GATE2020: 4
Which class of antibody is first made by developing $B$ cells inside bone marrow? $IgG$ $IgE$ $IgA$ $IgM$
Which class of antibody is first made by developing $B$ cells inside bone marrow?$IgG$$IgE$$IgA$$IgM$
0 votes
0 answers
236
GATE2013-21
A callus of $\text{5 g}$ dry weight was inoculated on semi-solid medium for growth. The dry weight of the callus was found to increase by $1.5$ fold after $10$ days of inoculation. The growth index of the culture is ____________.
A callus of $\text{5 g}$ dry weight was inoculated on semi-solid medium for growth. The dry weight of the callus was found to increase by $1.5$ fold after $10$ days of in...
0 votes
0 answers
237
GATE2012-22
While searching a database for similar sequences, E value does NOT depend on the sequence length number of sequences in the database scoring system probability from a normal distribution
While searching a database for similar sequences, E value does NOT depend on thesequence lengthnumber of sequences in the databasescoring systemprobability from a normal ...
0 votes
0 answers
240
GATE2016-30
Select the CORRECT combination of genetic components that are essential for the transfer of T-DNA segment from Agrobacterium tumefaciens to plant cells. Border repeat sequences and oncogenes Border repeat sequences and vir genes Opine biosynthetic genes and vir genes Opine biosynthetic genes and oncogenes
Select the CORRECT combination of genetic components that are essential for the transfer of T-DNA segment from Agrobacterium tumefaciens to plant cells.Border repeat sequ...
Page: