Log In
Welcome to GATE BioTechnology, where you can ask questions and receive answers from other members of the community.

Recent questions tagged gate2015

0 votes
0 answers
Choose the most appropriate word from the options given below to complete the following sentence. The principal presented the chief guest with a _________, as token of appreciation. momento memento momentum moment
asked Mar 26, 2018 in Verbal Ability Milicevic3306 7.9k points
0 votes
0 answers
Choose the appropriate word/phrase, out of the four options given below, to complete the following sentence: Frogs _________ croak roar hiss patter
asked Mar 26, 2018 in Verbal Ability Milicevic3306 7.9k points
0 votes
0 answers
Choose the word most similar in meaning to the given word: Educe Exert Educate Extract Extend
asked Mar 26, 2018 in Verbal Ability Milicevic3306 7.9k points
0 votes
0 answers
Operators $\square$, $\lozenge$ and $\rightarrow$ are defined by: $a \: \square \: b = \dfrac{a-b}{a+b}$; $a \: \lozenge \: b = \dfrac{a+b}{a-b}$; $a \rightarrow b = ab$. Find the value of $(66 \: \square \: 6) \rightarrow (66 \: \lozenge \: 6)$. $-2$ $-1$ $1$ $2$
asked Mar 26, 2018 in Numerical Ability Milicevic3306 7.9k points
0 votes
0 answers
If $\log_x (5/7) = -1/3$, then the value of $x$ is $343/125$ $125/343$ $-25/49$ $-49/25$
asked Mar 26, 2018 in Numerical Ability Milicevic3306 7.9k points
0 votes
0 answers
The following question presents a sentence. part of which is underlined. Beneath the sentence you find four ways of phrasing the underlined part. Following the requirements of the standard written English, select the answer that produces the most effective sentence. Tuberculosis, together ... causes of death has the rank of one of the leading causes of death are one of the leading causes of death
asked Mar 26, 2018 in Verbal Ability Milicevic3306 7.9k points
0 votes
0 answers
Read the following paragraph and choose the correct statement. Climate change has reduced human security and threatened human well being. An ignored reality of human progress is that human security largely depends upon environmental security. ... contradictory to environmental security. Human security is contradictory to environmental security. Human progress depends upon environmental security.
asked Mar 26, 2018 in Verbal Ability Milicevic3306 7.9k points
0 votes
0 answers
A cube of side $3$ units is formed using a set of smaller cubes of side $1$ unit. Find the proportion of the number of faces of the smaller cubes visible to those which are NOT visible. $1:4$ $1:3$ $1:2$ $2:3$
asked Mar 26, 2018 in Numerical Ability Milicevic3306 7.9k points
0 votes
0 answers
Humpty Dumpty sits on a all every day while having lunch. The wall sometimes breaks. A person sitting on the all falls if the wall breaks. Which one of the statements below is logically valid and can be inferred from the above sentences? Humpty Dumpty always ... sometimes while having lunch Humpty Dumpty never falls during dinner When Humpty Dumpty does not sit on the wall, the wall does not break
asked Mar 26, 2018 in Verbal Ability Milicevic3306 7.9k points
0 votes
0 answers
Which one of the following complement proteins is the initiator of the membrane attack complex $C3a$ $C3b$ $C5a$ $C5b$
asked Mar 26, 2018 in Others Milicevic3306 7.9k points
0 votes
0 answers
Levinthal’s paradox is related to protein secretion protein degradation protein folding protein trafficking
asked Mar 26, 2018 in Others Milicevic3306 7.9k points
0 votes
0 answers
Which one of the following is a second generation genetically engineered crop? Bt brinjal Roundup soyabean Golden rice Bt rice
asked Mar 26, 2018 in Others Milicevic3306 7.9k points
0 votes
0 answers
Based on the heavy chain, which one of the following antibodies has multiple subtypes? IgM IgD IgE IgG
asked Mar 26, 2018 in Others Milicevic3306 7.9k points
0 votes
0 answers
The Cytokinetic organelle in plant cells is centriole Phragmoplast proplastid chromoplastid
asked Mar 26, 2018 in Others Milicevic3306 7.9k points
0 votes
0 answers
Anergy refers to nitochondrial dysfunction allergy to environmental antigens unresponsiveness to antigens a state of no energy
asked Mar 26, 2018 in Others Milicevic3306 7.9k points
0 votes
0 answers
ABO blood group antigens in humans are differentiated from each other on the basis of sialic acid lipids spectrin glycoproteins
asked Mar 26, 2018 in Others Milicevic3306 7.9k points
0 votes
0 answers
Which one of the following organisms is used for the determination of phenol coefficient of a disinfectant? Salmonella typhi Escherichia coli Candida albicans Bacillus psychrophilus
asked Mar 26, 2018 in Others Milicevic3306 7.9k points
0 votes
0 answers
A single subunit enzyme converts $420$ $\mu$moles of substrate to product in one minute. The activity of the enzyme is ________ $\times 10^{-6}$ Kalal.
asked Mar 26, 2018 in Others Milicevic3306 7.9k points
0 votes
0 answers
Which one of the following amino acids has the highest probability to be found on the surface of a typical globular protein in aqueous environment? Ala Val Arg Ile
asked Mar 26, 2018 in Others Milicevic3306 7.9k points
0 votes
0 answers
Which one of the following is NOT a product of denitrification in Pseuadomonas? $N_2$ $N_2O$ $NO_2^-$ $NH_4^+$
asked Mar 26, 2018 in Others Milicevic3306 7.9k points
0 votes
0 answers
The determinant of the matrix $\begin{bmatrix} 3 & 0 & 0 \\ 2 & 5 & 0 \\ 6 & -8 & -4 \end{bmatrix}$ is __________
asked Mar 26, 2018 in Others Milicevic3306 7.9k points
0 votes
0 answers
Which one of the following features is NOT required in a prokaryotic expression vector? $\textit{oriC}$ Selection marker CMV promoter Ribosome binding site
asked Mar 26, 2018 in Others Milicevic3306 7.9k points
0 votes
0 answers
Production of monoclonal antibodies by hybridoma technology requires splenocytes osteocytes hepatocytes thymocytes
asked Mar 26, 2018 in Others Milicevic3306 7.9k points
0 votes
0 answers
Which one of the following is INCORRECT about a typical apoptotic cell? Phosphatidylserine is presented on the outer cell surface Cytochrome c is released from mitochondria Mitochondrial membrane potential does not change Annexin-V binds to the cell surface
asked Mar 26, 2018 in Others Milicevic3306 7.9k points
0 votes
0 answers
Identify the file format given below: $>$P$1$; JMFD Protein X – Homo sapiens MKALTARQQEVFDLIRDHISRTLRQQGDWL GDE FASTA NBRF GCG
asked Mar 26, 2018 in Others Milicevic3306 7.9k points
0 votes
0 answers
Which one of the following relations holds true for the specific growth rate $(\mu)$ of a microorganism in the death phase? $\mu=0$ $\mu<0$ $\mu=\mu_{\text{max}}$ $0<\mu<\mu_{\text{max}}$
asked Mar 26, 2018 in Others Milicevic3306 7.9k points
0 votes
0 answers
How many $3$-tuples are possible for the following amino acid sequence? MADCMWDISEASE $4$ $5$ $11$ $12$
asked Mar 26, 2018 in Others Milicevic3306 7.9k points
0 votes
0 answers
How many different protein sequences of $100$ residues can be generated using $20$ standard amino acids? $100^{20}$ $100 \times 20$ $20^{100}$ $100! \times 20!$
asked Mar 26, 2018 in Others Milicevic3306 7.9k points
0 votes
0 answers
In DNA sequencing reactions using the chain termination method, the ratio of ddNTPs to dNTPs should be $0$ $< 1$ $1$ $>1$
asked Mar 26, 2018 in Others Milicevic3306 7.9k points
0 votes
0 answers
Which one of the following graphs represents uncompetitive inhibition?
asked Mar 26, 2018 in Others Milicevic3306 7.9k points
0 votes
0 answers
Choose the appropriate pair of primers to amplify the following DNA fragment by the polymerase chain reaction (PCR). $\textrm{5' - GACCTGTGG- - - - - - - - - - - - - - - - - - ATACGGGAT - 3'}$ $\textrm{3' - CTGGACACC - - - - - - - - - - - - - - - - - - TATGCCCTA - 5'}$ ... $P$ and $R$ $P$ and $S$ $Q$ and $R$ $Q$ and $S$
asked Mar 26, 2018 in Others Milicevic3306 7.9k points
0 votes
0 answers
Consider the following infinite series: $1+ r+r^2 +r^3+ \dots \dots \infty$ If $r = 0.3$, then the sum of this infinite series is ____________
asked Mar 26, 2018 in Calculus Milicevic3306 7.9k points
0 votes
0 answers
$\begin{array}{cc} 2x_1+ x_2 = 35 \\ 5x_1 + bx_2 = 7.5 \end{array}$ The system of linear equations in two variables shown above will have infinite solutions, if and only if, $b$ is equal to _________
asked Mar 26, 2018 in Linear Algebra Milicevic3306 7.9k points
0 votes
0 answers
The interaction between an antigen $(Ag)$ and a single-chain antibody $(Ab)$ was studied using Scatchard analysis. The result is shown below. The affinity of interaction and the total concentration of antibody, respectively, can be determined from slope and $Y$-intercept $Y$-intercept and slope $X$-intercept and slope slope and $X$-intercept
asked Mar 26, 2018 in Others Milicevic3306 7.9k points
0 votes
0 answers
An isolated population on an island has the following genotypic frequencies: $\begin{array}{|c|c|c|c|} \hline \textrm{Genotype} & AA & Aa & aa \\ \hline \textrm{Frequency} & 0.3 & 0.4 & 0.3 \\ \hline \end{array}$ Assuming that there are only two alleles ($A$ and $a$) for the gene, the genotypic frequency of $AA$ in the next generation will be __________
asked Mar 26, 2018 in Others Milicevic3306 7.9k points
0 votes
0 answers
How many rooted and unrooted phylogenetic trees, respectively, are possible with four different sequences? $3$ and $15$ $15$ and $3$ $15$ and $12$ $12$ and $3$
asked Mar 26, 2018 in Others Milicevic3306 7.9k points
0 votes
0 answers
Match the compounds in $\text{Group I}$ with the correct entries in $\text{Group II}$ ... $\text{P-5, Q-2, R-1, S-3}$ $\text{P-4, Q-2, R-1, S-3}$ $\text{P-4, Q-5, R-3, S-1}$
asked Mar 26, 2018 in Others Milicevic3306 7.9k points
0 votes
0 answers
For a discrete random variable $X$, $\textit{ran}(X)=\{0,1,2,3\}$ and the cumulative probability $F(X )$ is shown below: $\begin{array}{|c|c|c|c|c|} \hline X & 0 & 1 & 2 & 3 \\ \hline F(X) & 0.5 & 0.6 & 0.8 & 1.0 \\ \hline \end{array}$The mean value of $X$ is ___________
asked Mar 26, 2018 in Probability and Statistics Milicevic3306 7.9k points
0 votes
0 answers
The limit of the function $\bigg (1 + \dfrac{x}{n} \bigg )^n$ as $n \to \infty$ is $\ln x$ $\ln \dfrac{1}{x}$ $e^{-x}$ $e^x$
asked Mar 26, 2018 in Calculus Milicevic3306 7.9k points