Recent questions tagged gate2015

0 votes

0 answers

1

GATE2015-1
Choose the most appropriate word from the options given below to complete the following sentence. The principal presented the chief guest with a _________, as token of appreciation. momento memento momentum moment

Milicevic3306 asked in Verbal Aptitude Mar 26, 2018

by Milicevic3306

7.9k points

0 votes

0 answers

2

GATE2015-2
Choose the appropriate word/phrase, out of the four options given below, to complete the following sentence: Frogs _________ croak roar hiss patter

Milicevic3306 asked in Verbal Aptitude Mar 26, 2018

by Milicevic3306

7.9k points

0 votes

0 answers

3

GATE2015-3
Choose the word most similar in meaning to the given word: Educe Exert Educate Extract Extend

Milicevic3306 asked in Verbal Aptitude Mar 26, 2018

by Milicevic3306

7.9k points

0 votes

0 answers

4

GATE2015-4
Operators $\square$, $\lozenge$ and $\rightarrow$ are defined by: $a \: \square \: b = \dfrac{a-b}{a+b}$; $a \: \lozenge \: b = \dfrac{a+b}{a-b}$; $a \rightarrow b = ab$. Find the value of $(66 \: \square \: 6) \rightarrow (66 \: \lozenge \: 6)$. $-2$ $-1$ $1$ $2$

Milicevic3306 asked in Quantitative Aptitude Mar 26, 2018

by Milicevic3306

7.9k points

0 votes

0 answers

5

GATE2015-5
If $\log_x (5/7) = -1/3$, then the value of $x$ is $343/125$ $125/343$ $-25/49$ $-49/25$

Milicevic3306 asked in Quantitative Aptitude Mar 26, 2018

by Milicevic3306

7.9k points

0 votes

0 answers

6

GATE2015-6
The following question presents a sentence. part of which is underlined. Beneath the sentence you find four ways of phrasing the underlined part. Following the requirements of the standard written English, select the answer that produces the most effective sentence. Tuberculosis, ... causes of death has the rank of one of the leading causes of death are one of the leading causes of death

Milicevic3306 asked in Verbal Aptitude Mar 26, 2018

by Milicevic3306

7.9k points

0 votes

0 answers

7

GATE2015-7
Read the following paragraph and choose the correct statement. Climate change has reduced human security and threatened human well being. An ignored reality of human progress is that human security largely depends upon environmental security ... to environmental security. Human security is contradictory to environmental security. Human progress depends upon environmental security.

Milicevic3306 asked in Verbal Aptitude Mar 26, 2018

by Milicevic3306

7.9k points

0 votes

0 answers

8

GATE2015-8
Fill in the missing value

Milicevic3306 asked in Analytical Aptitude Mar 26, 2018

by Milicevic3306

7.9k points

0 votes

0 answers

9

GATE2015-9
A cube of side $3$ units is formed using a set of smaller cubes of side $1$ unit. Find the proportion of the number of faces of the smaller cubes visible to those which are NOT visible. $1:4$ $1:3$ $1:2$ $2:3$

Milicevic3306 asked in Quantitative Aptitude Mar 26, 2018

by Milicevic3306

7.9k points

0 votes

0 answers

10

GATE2015-10
Humpty Dumpty sits on a all every day while having lunch. The wall sometimes breaks. A person sitting on the all falls if the wall breaks. Which one of the statements below is logically valid and can be inferred from the above sentences? Humpty Dumpty ... while having lunch Humpty Dumpty never falls during dinner When Humpty Dumpty does not sit on the wall, the wall does not break

Milicevic3306 asked in Verbal Aptitude Mar 26, 2018

by Milicevic3306

7.9k points

0 votes

0 answers

11

GATE2015-11
Which one of the following complement proteins is the initiator of the membrane attack complex $C3a$ $C3b$ $C5a$ $C5b$

Milicevic3306 asked in Others Mar 26, 2018

by Milicevic3306

7.9k points

0 votes

0 answers

12

GATE2015-12
Levinthal’s paradox is related to protein secretion protein degradation protein folding protein trafficking

Milicevic3306 asked in Others Mar 26, 2018

by Milicevic3306

7.9k points

0 votes

0 answers

13

GATE2015-13
Which one of the following is a second generation genetically engineered crop? Bt brinjal Roundup soyabean Golden rice Bt rice

Milicevic3306 asked in Others Mar 26, 2018

by Milicevic3306

7.9k points

0 votes

0 answers

14

GATE2015-14
Based on the heavy chain, which one of the following antibodies has multiple subtypes? IgM IgD IgE IgG

Milicevic3306 asked in Others Mar 26, 2018

by Milicevic3306

7.9k points

0 votes

0 answers

15

GATE2015-15
The Cytokinetic organelle in plant cells is centriole Phragmoplast proplastid chromoplastid

Milicevic3306 asked in Others Mar 26, 2018

by Milicevic3306

7.9k points

0 votes

0 answers

16

GATE2015-16
Anergy refers to nitochondrial dysfunction allergy to environmental antigens unresponsiveness to antigens a state of no energy

Milicevic3306 asked in Others Mar 26, 2018

by Milicevic3306

7.9k points

0 votes

0 answers

17

GATE2015-17
ABO blood group antigens in humans are differentiated from each other on the basis of sialic acid lipids spectrin glycoproteins

Milicevic3306 asked in Others Mar 26, 2018

by Milicevic3306

7.9k points

0 votes

0 answers

18

GATE2015-18
Which one of the following organisms is used for the determination of phenol coefficient of a disinfectant? Salmonella typhi Escherichia coli Candida albicans Bacillus psychrophilus

Milicevic3306 asked in Others Mar 26, 2018

by Milicevic3306

7.9k points

0 votes

0 answers

19

GATE2015-19
A single subunit enzyme converts $420$ $\mu$moles of substrate to product in one minute. The activity of the enzyme is ________ $\times 10^{-6}$ Kalal.

Milicevic3306 asked in Others Mar 26, 2018

by Milicevic3306

7.9k points

0 votes

0 answers

20

GATE2015-20
Which one of the following amino acids has the highest probability to be found on the surface of a typical globular protein in aqueous environment? Ala Val Arg Ile

Milicevic3306 asked in Others Mar 26, 2018

by Milicevic3306

7.9k points

0 votes

0 answers

21

GATE2015-21
Which one of the following is NOT a product of denitrification in Pseuadomonas? $N_2$ $N_2O$ $NO_2^-$ $NH_4^+$

Milicevic3306 asked in Others Mar 26, 2018

by Milicevic3306

7.9k points

0 votes

0 answers

22

GATE2015-22
The determinant of the matrix $\begin{bmatrix} 3 & 0 & 0 \\ 2 & 5 & 0 \\ 6 & -8 & -4 \end{bmatrix}$ is __________

Milicevic3306 asked in Others Mar 26, 2018

by Milicevic3306

7.9k points

0 votes

0 answers

23

GATE2015-23
Which one of the following features is NOT required in a prokaryotic expression vector? $\textit{oriC}$ Selection marker CMV promoter Ribosome binding site

Milicevic3306 asked in Others Mar 26, 2018

by Milicevic3306

7.9k points

0 votes

0 answers

24

GATE2015-24
Production of monoclonal antibodies by hybridoma technology requires splenocytes osteocytes hepatocytes thymocytes

Milicevic3306 asked in Others Mar 26, 2018

by Milicevic3306

7.9k points

0 votes

0 answers

25

GATE2015-25
Which one of the following is INCORRECT about a typical apoptotic cell? Phosphatidylserine is presented on the outer cell surface Cytochrome c is released from mitochondria Mitochondrial membrane potential does not change Annexin-V binds to the cell surface

Milicevic3306 asked in Others Mar 26, 2018

by Milicevic3306

7.9k points

0 votes

0 answers

26

GATE2015-26
Identify the file format given below: $>$P$1$; JMFD Protein X – Homo sapiens MKALTARQQEVFDLIRDHISRTLRQQGDWL GDE FASTA NBRF GCG

Milicevic3306 asked in Others Mar 26, 2018

by Milicevic3306

7.9k points

0 votes

0 answers

27

GATE2015-27
Which one of the following relations holds true for the specific growth rate $(\mu)$ of a microorganism in the death phase? $\mu=0$ $\mu<0$ $\mu=\mu_{\text{max}}$ $0<\mu<\mu_{\text{max}}$

Milicevic3306 asked in Others Mar 26, 2018

by Milicevic3306

7.9k points

0 votes

0 answers

28

GATE2015-28
How many $3$-tuples are possible for the following amino acid sequence? MADCMWDISEASE $4$ $5$ $11$ $12$

Milicevic3306 asked in Others Mar 26, 2018

by Milicevic3306

7.9k points

0 votes

0 answers

29

GATE2015-29
How many different protein sequences of $100$ residues can be generated using $20$ standard amino acids? $100^{20}$ $100 \times 20$ $20^{100}$ $100! \times 20!$

Milicevic3306 asked in Others Mar 26, 2018

by Milicevic3306

7.9k points

0 votes

0 answers

30

GATE2015-30
In DNA sequencing reactions using the chain termination method, the ratio of ddNTPs to dNTPs should be $0$ $< 1$ $1$ $>1$

Milicevic3306 asked in Others Mar 26, 2018

by Milicevic3306

7.9k points

0 votes

0 answers

31

GATE2015-31
Which one of the following graphs represents uncompetitive inhibition?

Milicevic3306 asked in Others Mar 26, 2018

by Milicevic3306

7.9k points

0 votes

0 answers

32

GATE2015-32
Choose the appropriate pair of primers to amplify the following DNA fragment by the polymerase chain reaction (PCR). $\textrm{5' - GACCTGTGG- - - - - - - - - - - - - - - - - - ATACGGGAT - 3'}$ $\textrm{3' - CTGGACACC - - - - - - - - - - - - - - - - - - TATGCCCTA - 5'}$ ... $P$ and $R$ $P$ and $S$ $Q$ and $R$ $Q$ and $S$

Milicevic3306 asked in Others Mar 26, 2018

by Milicevic3306

7.9k points

0 votes

0 answers

33

GATE2015-33
Consider the following infinite series: $1+ r+r^2 +r^3+ \dots \dots \infty$ If $r = 0.3$, then the sum of this infinite series is ____________

Milicevic3306 asked in Calculus Mar 26, 2018

by Milicevic3306

7.9k points

0 votes

0 answers

34

GATE2015-34
$\begin{array}{cc} 2x_1+ x_2 = 35 \\ 5x_1 + bx_2 = 7.5 \end{array}$ The system of linear equations in two variables shown above will have infinite solutions, if and only if, $b$ is equal to _________

Milicevic3306 asked in Linear Algebra Mar 26, 2018

by Milicevic3306

7.9k points

0 votes

0 answers

35

GATE2015-35
The interaction between an antigen $(Ag)$ and a single-chain antibody $(Ab)$ was studied using Scatchard analysis. The result is shown below. The affinity of interaction and the total concentration of antibody, respectively, can be determined from slope and $Y$-intercept $Y$-intercept and slope $X$-intercept and slope slope and $X$-intercept

Milicevic3306 asked in Others Mar 26, 2018

by Milicevic3306

7.9k points

0 votes

0 answers

36

GATE2015-36
An isolated population on an island has the following genotypic frequencies: $\begin{array}{|c|c|c|c|} \hline \textrm{Genotype} & AA & Aa & aa \\ \hline \textrm{Frequency} & 0.3 & 0.4 & 0.3 \\ \hline \end{array}$ Assuming that there are only two alleles ($A$ and $a$) for the gene, the genotypic frequency of $AA$ in the next generation will be __________

Milicevic3306 asked in Others Mar 26, 2018

by Milicevic3306

7.9k points

0 votes

0 answers

37

GATE2015-37
How many rooted and unrooted phylogenetic trees, respectively, are possible with four different sequences? $3$ and $15$ $15$ and $3$ $15$ and $12$ $12$ and $3$

Milicevic3306 asked in Others Mar 26, 2018

by Milicevic3306

7.9k points

0 votes

0 answers

38

GATE2015-38
Match the compounds in $\text{Group I}$ with the correct entries in $\text{Group II}$ ... $\text{P-5, Q-2, R-1, S-3}$ $\text{P-4, Q-2, R-1, S-3}$ $\text{P-4, Q-5, R-3, S-1}$

Milicevic3306 asked in Others Mar 26, 2018

by Milicevic3306

7.9k points

0 votes

0 answers

39

GATE2015-40
For a discrete random variable $X$, $\textit{ran}(X)=\{0,1,2,3\}$ and the cumulative probability $F(X )$ is shown below: $\begin{array}{|c|c|c|c|c|} \hline X & 0 & 1 & 2 & 3 \\ \hline F(X) & 0.5 & 0.6 & 0.8 & 1.0 \\ \hline \end{array}$The mean value of $X$ is ___________

Milicevic3306 asked in Probability and Statistics Mar 26, 2018

by Milicevic3306

7.9k points

0 votes

0 answers

40

GATE2015-42
The limit of the function $\bigg (1 + \dfrac{x}{n} \bigg )^n$ as $n \to \infty$ is $\ln x$ $\ln \dfrac{1}{x}$ $e^{-x}$ $e^x$

Milicevic3306 asked in Calculus Mar 26, 2018

by Milicevic3306

7.9k points